PDB entry 1d8j

View 1d8j on RCSB PDB site
Description: solution structure of the central core domain of tfiie beta
Class: gene regulation
Keywords: WINGED HELIX-TURN-HELIX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, GENE REGULATION
Deposited on 1999-10-25, released 2000-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: general transcription factor tfiie-beta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29084 (0-80)
  Domains in SCOPe 2.08: d1d8ja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d8jA (A:)
  alsgssgykfgvlakivnymktrhqrgdthpltldeildetqhldiglkqkqwlmtealv
  nnpkievidgkyafkpkynvr