PDB entry 1d8i

View 1d8i on RCSB PDB site
Description: x-ray crystal structure of yeast RNA triphosphatase in complex with a sulfate ion.
Class: hydrolase
Keywords: RNA triphosphatase, beta subunit, polynucleotide 5'-triphosphatase, mRNA processing, mRNA capping, nuclear protein beta barrel, catalytic domain, dimer, sulfate complex, hydrolase
Deposited on 1999-10-24, released 1999-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA triphosphatase cet1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13297 (2-End)
      • conflict (3)
    Domains in SCOPe 2.07: d1d8ia_
  • Chain 'B':
    Compound: mRNA triphosphatase cet1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13297 (2-End)
      • conflict (3)
    Domains in SCOPe 2.07: d1d8ib_
  • Chain 'C':
    Compound: mRNA triphosphatase cet1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13297 (2-End)
      • conflict (3)
    Domains in SCOPe 2.07: d1d8ic_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8iA (A:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvglstqrprflrmstdiktgrvgqfiekrhvaqllly
    spkdsydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenh
    nqnsksrqsettheveleintpallnafdnitndskeyaslirtflnngtiirrklssls
    yeifegskkvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8iA (A:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvgprflrmstdiktgrvgqfiekrhvaqlllyspkds
    ydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenhsetth
    eveleintpallnafdnitndskeyaslirtflnngtiirrklsslsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d8iB (B:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvglstqrprflrmstdiktgrvgqfiekrhvaqllly
    spkdsydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenh
    nqnsksrqsettheveleintpallnafdnitndskeyaslirtflnngtiirrklssls
    yeifegskkvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8iB (B:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvgprflrmstdiktgrvgqfiekrhvaqlllyspkds
    ydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenhsetth
    eveleintpallnafdnitndskeyaslirtflnngtiirrklsslsy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d8iC (C:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvglstqrprflrmstdiktgrvgqfiekrhvaqllly
    spkdsydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenh
    nqnsksrqsettheveleintpallnafdnitndskeyaslirtflnngtiirrklssls
    yeifegskkvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8iC (C:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvgprflrmstdiktgrvgqfiekrhvaqlllyspkds
    ydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenhsetth
    eveleintpallnafdnitndskeyaslirtflnngtiirrklsslsy