PDB entry 1d8h

View 1d8h on RCSB PDB site
Description: x-ray crystal structure of yeast RNA triphosphatase in complex with sulfate and manganese ions.
Class: hydrolase
Keywords: RNA TRIPHOSPHATASE, BETA SUBUNIT, POLYNUCLEOTIDE 5'-TRIPHOSPHATASE, mRNA PROCESSING, mRNA CAPPING, NUCLEAR PROTEIN BETA BARREL, CATALYTIC DOMAIN, DIMER, MANGANESE-SULFATE COMPLEX, HYDROLASE
Deposited on 1999-10-24, released 1999-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA triphosphatase cet1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13297 (2-End)
      • conflict (3)
    Domains in SCOPe 2.07: d1d8ha_
  • Chain 'B':
    Compound: mRNA triphosphatase cet1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13297 (2-End)
      • conflict (3)
    Domains in SCOPe 2.07: d1d8hb_
  • Chain 'C':
    Compound: mRNA triphosphatase cet1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13297 (2-End)
      • conflict (3)
    Domains in SCOPe 2.07: d1d8hc_
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8hA (A:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvglstqrprflrmstdiktgrvgqfiekrhvaqllly
    spkdsydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenh
    nqnsksrqsettheveleintpallnafdnitndskeyaslirtflnngtiirrklssls
    yeifegskkvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8hA (A:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvgprflrmstdiktgrvgqfiekrhvaqlllyspkds
    ydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenhsetth
    eveleintpallnafdnitndskeyaslirtflnngtiirrklsslsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d8hB (B:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvglstqrprflrmstdiktgrvgqfiekrhvaqllly
    spkdsydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenh
    nqnsksrqsettheveleintpallnafdnitndskeyaslirtflnngtiirrklssls
    yeifegskkvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8hB (B:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvgprflrmstdiktgrvgqfiekrhvaqlllyspkds
    ydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenhsetth
    eveleintpallnafdnitndskeyaslirtflnngtiirrklsslsy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d8hC (C:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvglstqrprflrmstdiktgrvgqfiekrhvaqllly
    spkdsydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenh
    nqnsksrqsettheveleintpallnafdnitndskeyaslirtflnngtiirrklssls
    yeifegskkvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8hC (C:)
    hmyrnvpiwaqkwkptikalqsinvkdlkidpsflniipdddltksvqdwvyatiysiap
    elrsfielemkfgviidakgpdrvnppvssqcvfteldahltpnidaslfkelskyirgi
    sevtentgkfsiiesqtrdsvyrvgprflrmstdiktgrvgqfiekrhvaqlllyspkds
    ydvkislnlelpvpdndppekyksqspisertkdrvsyihndsctriditkvenhsetth
    eveleintpallnafdnitndskeyaslirtflnngtiirrklsslsy