PDB entry 1d8c

View 1d8c on RCSB PDB site
Description: malate synthase g complexed with magnesium and glyoxylate
Class: lyase
Keywords: alpha-beta barrel, tim barrel, glyoxylate cycle, enolization, condensation, concerted acid-base catalysis, lyase
Deposited on 1999-10-22, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37330
      • modified residue (121)
      • modified residue (153)
      • modified residue (293)
      • modified residue (343)
      • modified residue (365)
      • modified residue (392)
      • modified residue (411)
      • modified residue (414)
      • modified residue (421)
      • modified residue (424)
      • modified residue (460)
      • modified residue (464)
      • modified residue (469)
      • modified residue (475)
      • modified residue (507)
      • modified residue (510)
      • modified residue (514)
      • modified residue (517)
      • modified residue (628)
      • modified residue (662)
      • modified residue (679)
    Domains in SCOPe 2.07: d1d8ca_
  • Heterogens: SOR, MG, SO4, GLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8cA (A:)
    maqtitqsrlridanfkrfvdeevlpgtgldaaafwrnfdeivhdlapenrqllaerdri
    qaaldewhrsnpgpvkdkaayksflrelgylvpqpervtvettgidseitsqagpqlvvp
    amnaryalnaanarwgslydalygsdiipqegamvsgydpqrgeqviawvrrfldeslpl
    engsyqdvvafkvvdkqlriqlkngkettlrtpaqfvgyrgdaaaptcillknnglhiel
    qidangrigkddpahindviveaaistildcedsvaavdaedkillyrnllglmqgtlqe
    kmekngrqivrklnddrhytaadgseislhgrsllfirnvghlmtipviwdsegneipeg
    ildgvmtgaialydlkvqknsrtgsvyivkpkmhgpqevafanklftrietmlgmapntl
    kmgimdeerrtslnlrsciaqarnrvafintgfldrtgdemhsvmeagpmlrknqmkstp
    wikayernnvlsglfcglrgkaqigkgmwampdlmadmysqkgdqlragantawvpspta
    atlhalhyhqtnvqsvqaniaqtefnaefepllddlltipvaenanwsaqeiqqeldnnv
    qgilgyvvrwveqgigcskvpdihnvalmedratlrissqhianwlrhgiltkeqvqasl
    enmakvvdqqnagdpayrpmagnfanscafkaasdliflgvkqpngytepllhawrlrek
    esh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8cA (A:)
    qtitqsrlridanfkrfvdeevlpgtgldaaafwrnfdeivhdlapenrqllaerdriqa
    aldewhrsnpgpvkdkaayksflrelgylvpqpervtvettgidseitsqagpqlvvpam
    naryalnaanarwgslydalygsdiipqegamvsgydpqrgeqviawvrrfldeslplen
    gsyqdvvafkvvdkqlriqlkngkettlrtpaqfvgyrgdaaaptcillknnglhielqi
    dangrigkddpahindviveaaistildcedsvaavdaedkillyrnllglmqgtlqrkl
    nddrhytaadgseislhgrsllfirnvghlmtipviwdsegneipegildgvmtgaialy
    dlkvqknsrtgsvyivkpkmhgpqevafanklftrietmlgmapntlkmgimdeerrtsl
    nlrsciaqarnrvafintgfldrtgdemhsvmeagpmlrknqmkstpwikayernnvlsg
    lfcglrgkaqigkgmwampdlmadmysqkgdqlragantawvpsptaatlhalhyhqtnv
    qsvqaniaqtefnaefepllddlltipvaenanwsaqeiqqeldnnvqgilgyvvrwveq
    gigcskvpdihnvalmedratlrissqhianwlrhgiltkeqvqaslenmakvvdqqnag
    dpayrpmagnfanscafkaasdliflgvkqpngytepllhawrlrekes