PDB entry 1d8b

View 1d8b on RCSB PDB site
Description: nmr structure of the hrdc domain from saccharomyces cerevisiae recq helicase
Class: DNA binding protein
Keywords: five helices, three-helical bundle flanked by two helices, DNA binding protein
Deposited on 1999-10-21, released 2000-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sgs1 recq helicase
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35187 (0-80)
  Domains in SCOPe 2.06: d1d8ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d8bA (A:)
  elnnlrmtyerlrelslnlgnrmvppvgnfmpdsilkkmaailpmndsafatlgtvedky
  rrrfkyfkatiadlskkrsse