PDB entry 1d8b

View 1d8b on RCSB PDB site
Description: nmr structure of the hrdc domain from saccharomyces cerevisiae recq helicase
Class: DNA binding protein
Keywords: five helices, three-helical bundle flanked by two helices, DNA binding protein
Deposited on 1999-10-21, released 2000-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sgs1 recq helicase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d8ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d8bA (A:)
    elnnlrmtyerlrelslnlgnrmvppvgnfmpdsilkkmaailpmndsafatlgtvedky
    rrrfkyfkatiadlskkrsse