PDB entry 1d7y

View 1d7y on RCSB PDB site
Description: crystal structure of nadh-dependent ferredoxin reductase, bpha4
Deposited on 1999-10-21, released 2000-12-20
The last revision prior to the SCOP 1.57 freeze date was dated 2000-12-20, with a file datestamp of 2000-12-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7yA (A:)
    alkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaeki
    rldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlqgatm
    pvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprlmsra
    apatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlandala
    raaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarh
    lvdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivg
    atcvnnardfaplrrllavgakpdraaladpatdlrklaaa