PDB entry 1d7w

View 1d7w on RCSB PDB site
Description: crystal structure of human myeloperoxidase isoform c complexed with cyanide and bromide at ph 4.0
Deposited on 1999-10-20, released 2001-12-12
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1d7w.1
  • Chain 'B':
    Domains in SCOP 1.59: d1d7w.2
  • Chain 'C':
    Domains in SCOP 1.59: d1d7w.1
  • Chain 'D':
    Domains in SCOP 1.59: d1d7w.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7wA (A:)
    cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
    aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7wB (B:)
    cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
    aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7wC (C:)
    vncetscvqqppcfplkippndpriknqadcipffrscpacpgsnitirnqinaltsfvd
    asmvygseeplarnlrnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripc
    flagdtrssempeltsmhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiit
    yrdylplvlgptamrkylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqp
    mepnprvplsrvffaswrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmr
    igldlpalnmqrsrdhglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpn
    nidiwmggvseplkrkgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqis
    lpriicdntgittvsknnifmsnsyprdfvncstlpalnlaswrea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7wD (D:)
    vncetscvqqppcfplkippndpriknqadcipffrscpacpgsnitirnqinaltsfvd
    asmvygseeplarnlrnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripc
    flagdtrssempeltsmhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiit
    yrdylplvlgptamrkylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqp
    mepnprvplsrvffaswrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmr
    igldlpalnmqrsrdhglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpn
    nidiwmggvseplkrkgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqis
    lpriicdntgittvsknnifmsnsyprdfvncstlpalnlaswrea