PDB entry 1d7v

View 1d7v on RCSB PDB site
Description: crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma
Class: lyase
Keywords: enzyme complexes, catalytic mechanism, decarboxylation inhibitor, lyase
Deposited on 1999-10-19, released 1999-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (2,2-dialkylglycine decarboxylase (pyruvate))
    Species: Burkholderia cepacia [TaxId:292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d7va_
  • Heterogens: NA, K, NMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d7vA (A:)
    mslnddatfwrnarqhlvryggtfepmiierakgsfvydadgraildftsgqmsavlghc
    hpeivsvigeyagkldhlfsgmlsrpvvdlatrlanitppgldralllstgaesneaair
    maklvtgkyeivgfaqswhgmtgaaasatysagrkgvgpaavgsfaipapftyrprfern
    gaydylaeldyafdlidrqssgnlaafiaepilssggiielpdgymaalkrkceargmll
    ildeaqtgvgrtgtmfacqrdgvtpdiltlsktlgaglplaaivtsaaieerahelgylf
    ytthvsdplpaavglrvldvvqrdglvaranvmgdrlrrglldlmerfdcigdvrgrgll
    lgveivkdrrtkepadglgakitrecmnlglsmnivqlpgmggvfriappltvsedeidl
    glsllgqaieral
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d7vA (A:)
    lnddatfwrnarqhlvryggtfepmiierakgsfvydadgraildftsgqmsavlghchp
    eivsvigeyagkldhlfsgmlsrpvvdlatrlanitppgldralllstgaesneaairma
    klvtgkyeivgfaqswhgmtgaaasatysagrkgvgpaavgsfaipapftyrprfernga
    ydylaeldyafdlidrqssgnlaafiaepilssggiielpdgymaalkrkceargmllil
    deaqtgvgrtgtmfacqrdgvtpdiltlsktlgaglplaaivtsaaieerahelgylfyt
    thvsdplpaavglrvldvvqrdglvaranvmgdrlrrglldlmerfdcigdvrgrglllg
    veivkdrrtkepadglgakitrecmnlglsmnivqlpgmggvfriappltvsedeidlgl
    sllgqaieral