PDB entry 1d7q

View 1d7q on RCSB PDB site
Description: human translation initiation factor eif1a
Class: gene regulation
Keywords: ob-fold, beta-barrel, RNA-binding protein, gene regulation
Deposited on 1999-10-19, released 2000-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: translation initiation factor 1a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P47813 (0-142)
  Domains in SCOPe 2.08: d1d7qa_
• Chain 'B':
  Compound: protein (n-terminal histidine tag)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1D7Q (0-13)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d7qA (A:)
  pknkgkggknrrrgknenesekrelvfkedgqeyaqvikmlgngrleamcfdgvkrlchi
  rgklrkkvwintsdiilvglrdyqdnkadvilkynadearslkaygelpehakinetdtf
  gpgdddeiqfddigdddediddi
  

  
  
• Chain 'B':
  No sequence available.