PDB entry 1d7p

View 1d7p on RCSB PDB site
Description: crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 a
Deposited on 1999-10-19, released 1999-12-01
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-01, with a file datestamp of 1999-11-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Domains in SCOP 1.55: d1d7pm_

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d7pM (M:)
lnscsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewl
qvdfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsf
tpvvncldpplltrylrihpqswvhqialrmevlgceaq