PDB entry 1d7p

View 1d7p on RCSB PDB site
Description: Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
Class: blood clotting
Keywords: beta sandwich, blood clotting
Deposited on 1999-10-19, released 1999-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'M':
  Compound: coagulation factor viii precursor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00451 (0-158)
    • engineered (125)
  Domains in SCOPe 2.08: d1d7pm_
• Heterogens: SO4, CYS, GOL, HOH

PDB Chain Sequences:

• Chain 'M':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d7pM (M:)
  lnscsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewl
  qvdfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsf
  tpvvncldpplltrylrihpqswvhqialrmevlgceaq