PDB entry 1d7o

View 1d7o on RCSB PDB site
Description: crystal structure of brassica napus enoyl acyl carrier protein reductase complexed with nad and triclosan
Class: oxidoreductase
Keywords: triclosan, enoyl reductase, oxidoreductase
Deposited on 1999-10-19, released 1999-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.162
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-[acyl-carrier protein] reductase (nadh) precursor
    Species: Brassica napus [TaxId:3708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1d7oa_
  • Heterogens: NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7oA (A:)
    glpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnifetslrrgkfdq
    srvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaaecvrqdfgsi
    dilvhslangpevskplletsrkgylaaisassysfvsllshflpimnpggasisltyia
    seriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsraakaigfidtm
    ieysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgvaldspvf