PDB entry 1d7o

View 1d7o on RCSB PDB site
Description: crystal structure of brassica napus enoyl acyl carrier protein reductase complexed with nad and triclosan
Deposited on 1999-10-19, released 1999-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-10, with a file datestamp of 2000-01-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d7oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7oA (A:)
    glpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnifetslrrgkfdq
    srvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaaecvrqdfgsi
    dilvhslangpevskplletsrkgylaaisassysfvsllshflpimnpggasisltyia
    seriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsraakaigfidtm
    ieysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgvaldspvf