PDB entry 1d7l

View 1d7l on RCSB PDB site
Description: structure-function correlations of the reaction of reduced nicotinamide analogs with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins
Class: oxidoreductase
Keywords: phbh, flavin, substituted flavins, oxidoreductase
Deposited on 1999-10-18, released 2000-01-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-hydroxybenzoate hydroxylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d7la1, d1d7la2
  • Heterogens: SO4, RFL, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7lA (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekvedwsderfw
    telkarlpsevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyeeie