PDB entry 1d7k

View 1d7k on RCSB PDB site
Description: crystal structure of human ornithine decarboxylase at 2.1 angstroms resolution
Deposited on 1999-10-18, released 2000-10-25
The last revision prior to the SCOP 1.61 freeze date was dated 2000-10-25, with a file datestamp of 2000-10-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d7kA (A:)
    eefdchfldegftakdildqkinevsssddkdafyvadlgdilkkhlrwlkalprvtpfy
    avkcndskaivktlaatgtgfdcaskteiqlvqslgvpperiiyanpckqvsqikyaann
    gvqmmtfdsevelmkvarahpkaklvlriatddskavcrlsvkfgatlrtsrlllerake
    lnidvvgvsfhvgsgctdpetfvqaisdarcvfdmgaevgfsmylldigggfpgsedvkl
    kfeeitgvinpaldkyfpsdsgvriiaepgryyvasaftlavniiakkivlkeqtgsdde
    desseqtfmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldri
    vercdlpemhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfqnpdfp
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d7kA (A:)
    eefdchfldegftakdildqkinevsssddkdafyvadlgdilkkhlrwlkalprvtpfy
    avkcndskaivktlaatgtgfdcaskteiqlvqslgvpperiiyanpckqvsqikyaann
    gvqmmtfdsevelmkvarahpkaklvlriatddskavcrlsvkfgatlrtsrlllerake
    lnidvvgvsfhvgsgctdpetfvqaisdarcvfdmgaevgfsmylldigggfpgsedvkl
    kfeeitgvinpaldkyfpsdsgvriiaepgryyvasaftlavniiakkivlkeqteqtfm
    yyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldrivercdlpem
    hvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfqnpdfpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d7kB (B:)
    eefdchfldegftakdildqkinevsssddkdafyvadlgdilkkhlrwlkalprvtpfy
    avkcndskaivktlaatgtgfdcaskteiqlvqslgvpperiiyanpckqvsqikyaann
    gvqmmtfdsevelmkvarahpkaklvlriatddskavcrlsvkfgatlrtsrlllerake
    lnidvvgvsfhvgsgctdpetfvqaisdarcvfdmgaevgfsmylldigggfpgsedvkl
    kfeeitgvinpaldkyfpsdsgvriiaepgryyvasaftlavniiakkivlkeqtgsdde
    desseqtfmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldri
    vercdlpemhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d7kB (B:)
    eefdchfldegftakdildqkinevsssddkdafyvadlgdilkkhlrwlkalprvtpfy
    avkcndskaivktlaatgtgfdcaskteiqlvqslgvpperiiyanpckqvsqikyaann
    gvqmmtfdsevelmkvarahpkaklvlriatddskavcrlsvkfgatlrtsrlllerake
    lnidvvgvsfhvgsgctdpetfvqaisdarcvfdmgaevgfsmylldigggfpgsedvkl
    kfeeitgvinpaldkyfpsdsgvriiaepgryyvasaftlavniiakkivlkeqsseqtf
    myyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldrivercdlpe
    mhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq