PDB entry 1d7j

View 1d7j on RCSB PDB site
Description: fkbp complexed with 4-hydroxy-2-butanone
Deposited on 1999-10-18, released 1999-10-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-16, with a file datestamp of 2000-02-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d7ja_
  • Chain 'B':
    Domains in SCOP 1.55: d1d7jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7jA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7jB (B:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle