PDB entry 1d7e

View 1d7e on RCSB PDB site
Description: crystal structure of the p65 crystal form of photoactive yellow protein
Class: photosynthesis
Keywords: photoreceptor, photosynthesis
Deposited on 1999-10-17, released 2000-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d7ea_
  • Heterogens: HC4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d7eA (A:)
    vafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigknff
    kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
    rv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d7eA (A:)
    vafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigknff
    kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkaldsywvfvkrv