PDB entry 1d7d

View 1d7d on RCSB PDB site
Description: cytochrome domain of cellobiose dehydrogenase, hp3 fragment, ph 7.5
Deposited on 1999-10-16, released 2000-10-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d7da_
  • Chain 'B':
    Domains in SCOP 1.55: d1d7db_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7dA (A:)
    esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
    lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
    cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
    yqnyln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7dB (B:)
    esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
    lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
    cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
    yqnyln