PDB entry 1d7a

View 1d7a on RCSB PDB site
Description: crystal structure of e. coli pure-mononucleotide complex.
Class: lyase
Keywords: three-layer (alpha-beta-alpha) sandwich n5-cair mutase (pure), aminoimidazole ribonucleotide (air), lyase
Deposited on 1999-10-16, released 1999-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (0-160)
      • conflict (0)
      • engineered (7)
      • engineered (16)
      • engineered (72)
      • engineered (103)
    Domains in SCOPe 2.07: d1d7aa_
  • Chain 'B':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (0-160)
      • conflict (0)
      • engineered (7)
      • engineered (16)
      • engineered (72)
      • engineered (103)
    Domains in SCOPe 2.07: d1d7ab_
  • Chain 'C':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (0-160)
      • conflict (0)
      • engineered (7)
      • engineered (16)
      • engineered (72)
      • engineered (103)
    Domains in SCOPe 2.07: d1d7ac_
  • Chain 'D':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (0-160)
      • conflict (0)
      • engineered (7)
      • engineered (16)
      • engineered (72)
      • engineered (103)
    Domains in SCOPe 2.07: d1d7ad_
  • Chain 'L':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (0-160)
      • conflict (0)
      • engineered (7)
      • engineered (16)
      • engineered (72)
      • engineered (103)
    Domains in SCOPe 2.07: d1d7al_
  • Chain 'M':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (0-160)
      • conflict (0)
      • engineered (7)
      • engineered (16)
      • engineered (72)
      • engineered (103)
    Domains in SCOPe 2.07: d1d7am_
  • Chain 'N':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (0-160)
      • conflict (0)
      • engineered (7)
      • engineered (16)
      • engineered (72)
      • engineered (103)
    Domains in SCOPe 2.07: d1d7an_
  • Chain 'O':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (0-160)
      • conflict (0)
      • engineered (7)
      • engineered (16)
      • engineered (72)
      • engineered (103)
    Domains in SCOPe 2.07: d1d7ao_
  • Heterogens: AIR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7aA (A:)
    garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
    iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
    anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7aB (B:)
    garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
    iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
    anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7aC (C:)
    garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
    iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
    anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7aD (D:)
    garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
    iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
    anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7aL (L:)
    garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
    iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
    anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7aM (M:)
    garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
    iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
    anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7aN (N:)
    garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
    iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
    anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7aO (O:)
    garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
    iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
    anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg