PDB entry 1d6z

View 1d6z on RCSB PDB site
Description: crystal structure of the aerobically freeze trapped rate-determining catalytic intermediate of e. coli copper-containing amine oxidase.
Deposited on 1999-10-16, released 2000-02-02
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-02, with a file datestamp of 2000-02-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6zA (A:)
    mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
    kawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrftei
    sllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahgm
    vllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkvi
    syldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkpm
    qiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggmi
    vpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipra
    iavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidaga
    tgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslvam
    dpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqii
    pyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglgq
    yskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6zB (B:)
    hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
    nkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrfte
    isllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahg
    mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
    isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkp
    mqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggm
    ivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipr
    aiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidag
    atgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslva
    mdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqi
    ipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglg
    qyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk