PDB entry 1d6v

View 1d6v on RCSB PDB site
Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation
Class: immune system
Keywords: immune system
Deposited on 1999-10-15, released 2000-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric germline precursor of oxy-cope catalytic antibody az-28 (heavy chain)
    Species: , [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot K7T9I5 (8-119)
      • expression tag (0-7)
      • conflict (98-103)
      • conflict (103)
      • conflict (103)
    • Uniprot P0DOX5 (120-220)
    Domains in SCOPe 2.07: d1d6vh1, d1d6vh2, d1d6vh3
  • Chain 'L':
    Compound: chimeric germline precursor of oxy-cope catalytic antibody az-28 (light chain)
    Species: , [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7TS98 (0-106)
      • conflict (95)
      • conflict (99)
    • Uniprot P01834 (107-210)
    Domains in SCOPe 2.07: d1d6vl1, d1d6vl2
  • Heterogens: CD, HOP, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6vH (H:)
    qvqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgstny
    nekfkgkatftadtssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6vL (L:)
    dikmtqspssmyaslgervtitckasqdinsylswfqqkpgkspktliyranrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr