PDB entry 1d6t

View 1d6t on RCSB PDB site
Description: rnase p protein from staphylococcus aureus
Deposited on 1999-10-15, released 2000-10-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-27, with a file datestamp of 2000-10-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d6ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6tA (A:)
    mllekayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrn
    kikrairenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfnkkik