PDB entry 1d6t

View 1d6t on RCSB PDB site
Description: RNAse p protein from staphylococcus aureus
Class: hydrolase
Keywords: endonuclease, RNAse, subunit, hydrolase
Deposited on 1999-10-15, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease p
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A0H5 (0-116)
  Domains in SCOPe 2.08: d1d6ta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d6tA (A:)
  mllekayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrn
  kikrairenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfnkkik