PDB entry 1d6s

View 1d6s on RCSB PDB site
Description: crystal structure of the k41a mutant of o-acetylserine sulfhydrylase complexed in external aldimine linkage with methionine
Class: lyase
Keywords: cysteine biosynthesis, beta replacement enzyme, plp, k41a, lyase
Deposited on 1999-10-15, released 2000-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-acetylserine sulfhydrylase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12674 (0-321)
      • engineered (40)
      • conflict (265-266)
    Domains in SCOPe 2.07: d1d6sa_
  • Chain 'B':
    Compound: O-acetylserine sulfhydrylase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12674 (0-321)
      • engineered (40)
      • conflict (265-266)
    Domains in SCOPe 2.07: d1d6sb_
  • Heterogens: MET, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6sA (A:)
    skiyednsltightplvrlnrigngrilakvesrnpsfsvacriganmiwdaekrgvlkp
    gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
    ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
    klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sgerylstalfadlftekelqq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6sB (B:)
    skiyednsltightplvrlnrigngrilakvesrnpsfsvacriganmiwdaekrgvlkp
    gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
    ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
    klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sgerylstalfadlftekelqq