PDB entry 1d6r
View 1d6r on RCSB PDB site
Description: crystal structure of cancer chemopreventive bowman-birk inhibitor in ternary complex with bovine trypsin at 2.3 a resolution. structural basis of janus-faced serine protease inhibitor specificity
Class: hydrolase
Keywords: protease inhibitor, serine protease, bowman-birk inhibitor, hydrolase
Deposited on
1999-10-15, released
2000-05-05
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-04, with a file datestamp of
2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: trypsinogen
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1d6ra_ - Chain 'I':
Compound: bowman-birk proteinase inhibitor precursor
Species: Glycine max [TaxId:3847]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1d6ri_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1d6rA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>1d6rI (I:)
kpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepck