PDB entry 1d6q

View 1d6q on RCSB PDB site
Description: human lysozyme e102 mutant labelled with 2',3'-epoxypropyl glycoside of n-acetyllactosamine
Class: hydrolase
Keywords: lysozyme, muramidase, hydrolase (o-glycosyl), n-acetyllactosamine, hydrolase
Deposited on 1999-10-15, released 2000-01-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00695 (0-129)
      • engineered (101)
    Domains in SCOPe 2.04: d1d6qa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6qA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrepqgirawvawrnrcqnrd
    vrqyvqgcgv