PDB entry 1d6p

View 1d6p on RCSB PDB site
Description:
Deposited on 1999-10-15, released 2000-01-21
The last revision prior to the SCOP 1.63 freeze date was dated 2000-01-21, with a file datestamp of 2000-01-20.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1d6pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6pA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srlwcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv