PDB entry 1d6n

View 1d6n on RCSB PDB site
Description: ternary complex structure of human hgprtase, prpp, mg2+, and the inhibitor hpp reveals the involvement of the flexible loop in substrate binding
Deposited on 1999-10-14, released 1999-12-30
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-30, with a file datestamp of 1999-12-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d6na_
  • Chain 'B':
    Domains in SCOP 1.55: d1d6nb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6nA (A:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlaggykffadlldyikalnrnsdrsipmtvdfirlgsycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6nB (B:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlaggykffadlldyikalnrnsdrsipmtvdfirlgsycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka