PDB entry 1d6n

View 1d6n on RCSB PDB site
Description: ternary complex structure of human hgprtase, prpp, mg2+, and the inhibitor hpp reveals the involvement of the flexible loop in substrate binding
Class: transferase
Keywords: hgprtase, transferase
Deposited on 1999-10-14, released 1999-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hypoxanthine-guanine phosphoribosyltransferase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00492 (0-213)
      • engineered (64)
      • conflict (98)
    Domains in SCOPe 2.07: d1d6na_
  • Chain 'B':
    Compound: protein (hypoxanthine-guanine phosphoribosyltransferase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00492 (0-213)
      • engineered (64)
      • conflict (98)
    Domains in SCOPe 2.07: d1d6nb_
  • Heterogens: MG, PPO, PRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6nA (A:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlaggykffadlldyikalnrnsdrsipmtvdfirlgsycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6nB (B:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlaggykffadlldyikalnrnsdrsipmtvdfirlgsycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka