PDB entry 1d6m

View 1d6m on RCSB PDB site
Description: crystal structure of e. coli DNA topoisomerase III
Class: isomerase
Keywords: DNA topoisomerase, decatenating enzyme
Deposited on 1999-10-14, released 2000-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.239
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase III
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d6ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d6mA (A:)
    mrlfiaekpslaraiadvlpkphrkgdgfiecgngqvvtwcighlleqaqpdaydsryar
    wnladlpivpekwqlqprpsvtkqlnvikrflheaseivhagdpdregqllvdevldylq
    lapekrqqvqrclindlnpqaveraidrlrsnsefvplcvsalararadwlyginmtray
    tilgrnagyqgvlsvgrvqtpvlglvvrrdeeienfvakdffevkahivtpaderftaiw
    qpseacepyqdeegrllhrplaehvvnrisgqpaivtsyndkresesaplpfslsalqie
    aakrfglsaqnvldicqklyethklityprsdcrylpeehfagrhavmnaisvhapdllp
    qpvvdpdirnrcwddkkvdahhaiiptarssainlteneakvynliarqylmqfcpdavf
    rkcvieldiakgkfvakarflaeagwrtllgskerdeendgtplpvvakgdellcekgev
    verqtqpprhftdatllsamtgiarfvqdkdlkkilratdglgteatragiiellfkrgf
    ltkkgryihstdagkalfhslpematrpdmtahwesvltqisekqcryqdfmqplvgtly
    qlidqakrtpvrqfrgivapgsggsadkkkaaprkrsakksppadevgsgaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d6mA (A:)
    mrlfiaekpslaraiadvlpkphrkgdgfiecgngqvvtwcighlleqaqpdaydsryar
    wnladlpivpekwqlqprpsvtkqlnvikrflheaseivhagdpdregqllvdevldylq
    lapekrqqvqrclindlnpqaveraidrlrsnsefvplcvsalararadwlyginmtray
    tilggvlsvgrvqtpvlglvvrrdeeienfvakdffevkahivtpaderftaiwqpseac
    epyqdeegrllhrplaehvvnrisgqpaivtsyndkresesaplpfslsalqieaakrfg
    lsaqnvldicqklyethklityprsdcrylpeehfagrhavmnaisvhapdllpqpvvdp
    dirnrcwddkkvdahhaiiptarssainlteneakvynliarqylmqfcpdavfrkcvie
    ldiakgkfvakarflaeagwrtllgskerdeendgtplpvvakgdellcekgevverqtq
    pprhftdatllsamtgiarfvqdkdlkkilratdglgteatragiiellfkrgfltkkgr
    yihstdagkalfhslpematrpdmtahwesvltqisekqcryqdfmqplvgtlyqlidqa
    krt