PDB entry 1d6j

View 1d6j on RCSB PDB site
Description: crystal structure of adenosine 5'-phosphosulfate (aps) kinase from penicillium chrysogenum
Class: transferase
Keywords: aps kinase, adenylylsulfate kinase, sulfate, nucleotide kinase, transferase
Deposited on 1999-10-13, released 2000-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine-5'phosphosulfate kinase
    Species: Penicillium chrysogenum [TaxId:5076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d6ja_
  • Chain 'B':
    Compound: adenosine-5'phosphosulfate kinase
    Species: Penicillium chrysogenum [TaxId:5076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d6jb_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d6jA (A:)
    mstnitfhasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrl
    dgdnirfglnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlh
    evatpgeetglpfvevyvdvpvevaeqrdpkglykkaregvikeftgisapyeapanpev
    hvknyelpvqdavkqiidyldtkgylpakke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d6jA (A:)
    hasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirf
    glnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpge
    etglpfvevyvdvpveapyeapanpevhvknyelpvqdavkqiidyldtkgylpakk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d6jB (B:)
    mstnitfhasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrl
    dgdnirfglnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlh
    evatpgeetglpfvevyvdvpvevaeqrdpkglykkaregvikeftgisapyeapanpev
    hvknyelpvqdavkqiidyldtkgylpakke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d6jB (B:)
    hasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirf
    glnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpge
    etglpfvevyvdvpvevaeqrapyeapanpevhvknyelpvqdavkqiidyldtkgylpa
    kk