PDB entry 1d6h

View 1d6h on RCSB PDB site
Description: chalone synthase (n336a mutant complexed with coa)
Class: transferase
Keywords: polypetide synthase, flavonoid biosynthesis, malonyl-coa decarboxylation, site-directed mutant, transferase
Deposited on 1999-10-13, released 2000-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.184
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone synthase
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (0-386)
      • engineered (333)
    Domains in SCOPe 2.06: d1d6ha1, d1d6ha2
  • Heterogens: SO4, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6hA (A:)
    svseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdk
    smikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpks
    kithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaennk
    garvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvwt
    aqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifwia
    hpggpaildqveqklalkpekmnatrevlseygamssacvlfildemrkkstqnglkttg
    eglewgvlfgfgpgltietvvlrsvai