PDB entry 1d6h

View 1d6h on RCSB PDB site
Description: chalone synthase (n336a mutant complexed with coa)
Deposited on 1999-10-13, released 2000-02-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-03, with a file datestamp of 2000-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.184
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6hA (A:)
    svseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdk
    smikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpks
    kithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgafaggtvlrlakdlaennk
    garvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvwt
    aqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifwia
    hpggpaildqveqklalkpekmnatrevlseygamssacvlfildemrkkstqnglkttg
    eglewgvlfgfgpgltietvvlrsvai