PDB entry 1d6g

View 1d6g on RCSB PDB site
Description: molecular complex of cholecystokinin-8 and n-terminus of the cholecystokinin a receptor by nmr spectroscopy
Class: hormone/growth factor
Keywords: alpha-helix, beta-sheet, complex GPCR-ligand, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 1999-10-13, released 1999-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholecystokinin type a receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32238 (0-46)
      • conflict (42-43)
    Domains in SCOPe 2.07: d1d6ga_
  • Chain 'B':
    Compound: cholecystokinin-8
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1D6G (0-End)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6gA (A:)
    mdvvdsllvngsnitppcelglenetlfcldqprpskewqpaqvill
    

  • Chain 'B':
    No sequence available.