PDB entry 1d6g

View 1d6g on RCSB PDB site
Description: molecular complex of cholecystokinin-8 and n-terminus of the cholecystokinin a receptor by nmr spectroscopy
Class: hormone/growth factor
Keywords: alpha-helix, beta-sheet, complex GPCR-ligand, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 1999-10-13, released 1999-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cholecystokinin type a receptor
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32238 (0-46)
    • conflict (42-43)
  Domains in SCOPe 2.08: d1d6ga_
• Chain 'B':
  Compound: cholecystokinin-8
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1D6G (0-End)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d6gA (A:)
  mdvvdsllvngsnitppcelglenetlfcldqprpskewqpaqvill
  

  
  
• Chain 'B':
  No sequence available.