PDB entry 1d6b

View 1d6b on RCSB PDB site
Description: solution structure of defensin-like peptide-2 (dlp-2) from platypus venom
Class: toxin
Keywords: helix, antiparallel beta-sheet, toxin
Deposited on 1999-10-12, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: defensin-like peptide-2
  Species: Ornithorhynchus anatinus [TaxId:9258]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82140 (0-41)
  Domains in SCOPe 2.08: d1d6ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d6bA (A:)
  imffemqacwshsgvcrdksernckpmawtycenrnqkccey