PDB entry 1d6a

View 1d6a on RCSB PDB site
Description: structure of pokeweed antiviral protein complexed with guanine
Class: hydrolase
Keywords: pokeweed antiviral protein, ribosome inactivating protein, hydrolase
Deposited on 1999-10-12, released 1999-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pokeweed antiviral protein
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d6aa_
  • Chain 'B':
    Compound: pokeweed antiviral protein
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d6ab_
  • Heterogens: GUN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6aA (A:)
    vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
    titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
    sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
    kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
    rvdeikpdvallnyvggscqtt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6aB (B:)
    vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
    titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
    sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
    kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
    rvdeikpdvallnyvggscqtt