PDB entry 1d66

View 1d66 on RCSB PDB site
Description: DNA recognition by gal4: structure of a protein/DNA complex
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1992-03-06, released 1992-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (gal4)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d66a1, d1d66a2
  • Chain 'B':
    Compound: protein (gal4)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d66b1, d1d66b2
  • Chain 'D':
    Compound: DNA (5'-d(*cp*cp*gp*gp*ap*gp*gp*ap*cp*ap*gp*tp*cp*cp*tp*cp*c p*gp*g)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*cp*cp*gp*gp*ap*gp*gp*ap*cp*tp*gp*tp*cp*cp*tp*cp*c p*gp*g)-3')
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d66A (A:)
    mkllssieqacdicrlkklkcskekpkcakclknnwecryspktkrspltrahltevesr
    lerlef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d66A (A:)
    eqacdicrlkklkcskekpkcakclknnwecryspktkrspltrahltevesrlerl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d66B (B:)
    mkllssieqacdicrlkklkcskekpkcakclknnwecryspktkrspltrahltevesr
    lerlef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d66B (B:)
    eqacdicrlkklkcskekpkcakclknnwecryspktkrspltrahltevesrlerl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.