PDB entry 1d5y

View 1d5y on RCSB PDB site
Description: crystal structure of the e. coli rob transcription factor in complex with dna
Deposited on 1999-10-12, released 2000-04-24
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-24, with a file datestamp of 2000-04-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.254
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d5yA (A:)
    qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayirarrlsks
    avalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirpplrlge
    ftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygln
    etrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefilt
    vygtcmpmlnltrrkgqdieryypaedakagdrpinlrcellipirrklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5yA (A:)
    qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayirarrlsks
    avalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirpplrlge
    ftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygln
    etrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefilt
    vygtcmpmlnltrrkgqdieryypaeddrpinlrcellipirrklaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d5yB (B:)
    qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayirarrlsks
    avalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirpplrlge
    ftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygln
    etrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefilt
    vygtcmpmlnltrrkgqdieryypaedakagdrpinlrcellipirrklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5yB (B:)
    qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayirarrlsks
    avalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirpplrlge
    ftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygln
    etrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefilt
    vygtcmpmlnltrrkgqdieryypaeddrpinlrcellipirrklaaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d5yC (C:)
    qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayirarrlsks
    avalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirpplrlge
    ftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygln
    etrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefilt
    vygtcmpmlnltrrkgqdieryypaedakagdrpinlrcellipirrklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5yC (C:)
    qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayirarrlsks
    avalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirpplrlge
    ftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygln
    etrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefilt
    vygtcmpmlnltrrkgqdieryypaeddrpinlrcellipirrklaaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d5yD (D:)
    qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayirarrlsks
    avalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirpplrlge
    ftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygln
    etrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefilt
    vygtcmpmlnltrrkgqdieryypaedakagdrpinlrcellipirrklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5yD (D:)
    qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayirarrlsks
    avalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirpplrlge
    ftmpehkfvtledtpligvtqsyscsleqisdfrhemryqfwhdflgnaptippvlygln
    etrpsqdkddeqevfyttalaqdqadgyvltghpvmlqggeyvmftyeglgtgvqefilt
    vygtcmpmlnltrrkgqdieryypaeddrpinlrcellipirrklaaa