PDB entry 1d5w

View 1d5w on RCSB PDB site
Description: phosphorylated fixj receiver domain
Class: gene regulation
Keywords: doubly wound five-stranded beta/alpha fold, phosphorylated protein, nitrogen fixation regulation, gene regulation
Deposited on 1999-10-12, released 2000-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein fixj
    Species: Sinorhizobium meliloti [TaxId:382]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10958 (0-End)
      • engineered (1)
      • engineered (53)
    Domains in SCOPe 2.06: d1d5wa_
  • Chain 'B':
    Compound: transcriptional regulatory protein fixj
    Species: Sinorhizobium meliloti [TaxId:382]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10958 (0-End)
      • engineered (1)
      • engineered (53)
    Domains in SCOPe 2.06: d1d5wb_
  • Chain 'C':
    Compound: transcriptional regulatory protein fixj
    Species: Sinorhizobium meliloti [TaxId:382]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10958 (0-End)
      • engineered (1)
      • engineered (53)
    Domains in SCOPe 2.06: d1d5wc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d5wA (A:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlvale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5wA (A:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d5wB (B:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlvale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5wB (B:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d5wC (C:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlvale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5wC (C:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hl