PDB entry 1d5v

View 1d5v on RCSB PDB site
Description: solution structure of the forkhead domain of the adipocyte-transcription factor freac-11 (s12)
Class: gene regulation
Keywords: winged helix, DNA-recognition helix, gene regulation
Deposited on 1999-10-12, released 2000-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: s12 transcription factor (fkh-14)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99958 (0-93)
    • conflict (0)
  Domains in SCOPe 2.08: d1d5va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d5vA (A:)
  mlvkppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslne
  cfvkvprddkkpgkgsywtldpdsynmfengsfl