PDB entry 1d5t

View 1d5t on RCSB PDB site
Description: guanine nucleotide dissociation inhibitor, alpha-isoform
Deposited on 1999-10-11, released 2000-10-25
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-25, with a file datestamp of 2000-10-25.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.172
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5tA (A:)
    hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql
    legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk
    vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg
    qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf
    arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvrkagqvi
    riicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyiaiasttve
    ttdpekevepalgllepidqkfvaisdlyepiddgsesqvfcscsydatthfettcndik
    diykrmagsafdf