PDB entry 1d5t

View 1d5t on RCSB PDB site
Description: guanine nucleotide dissociation inhibitor, alpha-isoform
Class: hydrolase inhibitor
Keywords: hydrolase inhibitor
Deposited on 1999-10-11, released 2000-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide dissociation inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21856 (2-432)
      • conflict (0-1)
    Domains in SCOPe 2.07: d1d5ta1, d1d5ta2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5tA (A:)
    hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql
    legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk
    vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg
    qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf
    arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvrkagqvi
    riicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyiaiasttve
    ttdpekevepalgllepidqkfvaisdlyepiddgsesqvfcscsydatthfettcndik
    diykrmagsafdf