PDB entry 1d5r

View 1d5r on RCSB PDB site
Description: crystal structure of the pten tumor suppressor
Deposited on 1999-10-11, released 1999-11-04
The last revision prior to the SCOP 1.63 freeze date was dated 1999-11-04, with a file datestamp of 1999-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d5rA (A:)
    rryqedgfdldltyiypniiamgfpaerlegvyrnniddvvrfldskhknhykiynlcae
    rhydtakfncrvaqypfedhnppqlelikpfcedldqwlseddnhvaaihckagkgrtgv
    micayllhrgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyllknhldyrpval
    lfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqplpvcgdi
    kveffhkqnkmlkkdkmfhfwvntffipgpeevdndkeylvltltkndldkankdkanry
    fspnfkvklyftktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5rA (A:)
    rryqedgfdldltyiypniiamgfpaerlegvyrnniddvvrfldskhknhykiynlcae
    rhydtakfncrvaqypfedhnppqlelikpfcedldqwlseddnhvaaihckagkgrtgv
    micayllhrgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyllknhldyrpval
    lfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqplpvcgdi
    kveffhkqnkmlkkdkmfhfwvntffipkeylvltltkndldkankdkanryfspnfkvk
    lyftktv