PDB entry 1d5n

View 1d5n on RCSB PDB site
Description: crystal structure of e. coli mnsod at 100k
Class: oxidoreductase
Keywords: manganese superoxide dismutase, oxidoreductase
Deposited on 1999-10-08, released 2000-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (manganese superoxide dismutase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1d5na1, d1d5na2
  • Chain 'B':
    Compound: protein (manganese superoxide dismutase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1d5nb1, d1d5nb2
  • Chain 'C':
    Compound: protein (manganese superoxide dismutase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1d5nc1, d1d5nc2
  • Chain 'D':
    Compound: protein (manganese superoxide dismutase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1d5nd1, d1d5nd2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5nA (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5nB (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5nC (C:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5nD (D:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk