PDB entry 1d5k

View 1d5k on RCSB PDB site
Description: solution structure of the archaeal translation elongation factor 1beta from methanobacterium thermoautotrophicum
Class: gene regulation
Keywords: alpha-beta sandwich, gene regulation
Deposited on 1999-10-07, released 2000-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2000-12-13, with a file datestamp of 2007-04-25.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: translation elongation factor 1beta
  Species: Methanobacterium thermoautotrophicum
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27734 (0-88)
  Domains in SCOPe 2.08: d1d5ka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d5kA (A:)
  mgdvvatikvmpespdvdlealkkeiqeripegtelhkideepiafglvalnvmvvvgda
  eggteaaeeslsgiegvsnievtdvrrlm