PDB entry 1d5i

View 1d5i on RCSB PDB site
Description: unliganded germline precursor of an oxy-cope catalytic antibody
Class: immune system
Keywords: immune system
Deposited on 1999-10-07, released 2000-02-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric germline precursor of oxy-cope catalytic antibody az-28 (heavy chain)
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-119)
      • see remark 999 (31)
      • see remark 999 (56)
      • see remark 999 (58)
      • see remark 999 (73)
    • Uniprot P01857 (120-220)
    Domains in SCOPe 2.03: d1d5ih1, d1d5ih2
  • Chain 'L':
    Compound: chimeric germline precursor of oxy-cope catalytic antibody az-28 (light chain)
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01834 (0-106)
      • see remark 999 (33)
      • see remark 999 (50)
      • not in sws entry (107)
    • Uniprot P01834 (108-210)
    Domains in SCOPe 2.03: d1d5il1, d1d5il2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5iH (H:)
    qvqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgstny
    nekfkgkatftadtssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5iL (L:)
    dikmtqspssmyaslgervtitckasqdinsylswfqqkpgkspktliyranrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr