PDB entry 1d5i

View 1d5i on RCSB PDB site
Description: unliganded germline precursor of an oxy-cope catalytic antibody
Deposited on 1999-10-07, released 2000-02-09
The last revision prior to the SCOP 1.71 freeze date was dated 2000-02-09, with a file datestamp of 2000-02-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5iH (H:)
    qvqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgstny
    nekfkgkatftadtssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5iL (L:)
    dikmtqspssmyaslgervtitckasqdinsylswfqqkpgkspktliyranrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr