PDB entry 1d5h

View 1d5h on RCSB PDB site
Description: Rnase s(f8a). mutant ribonucleasE S.
Class: hydrolase
Keywords: RNAse s mutant f8a cavity s protein s peptide, hydrolase
Deposited on 1999-10-07, released 1999-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: s peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-14)
    • engineered mutation (7)
  Domains in SCOPe 2.08: d1d5h.1
• Chain 'B':
  Compound: RNAse s
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00656 (0-100)
  Domains in SCOPe 2.08: d1d5h.1
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d5hA (A:)
  ketaaakaerqhmds
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d5hB (B:)
  nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
  cretgsskypncaykttqankhiivacegnpyvpvhfdasv