PDB entry 1d5h

View 1d5h on RCSB PDB site
Description: Rnase s(f8a). mutant ribonucleasE S.
Class: hydrolase
Keywords: RNAse s mutant f8a cavity s protein s peptide, hydrolase
Deposited on 1999-10-07, released 1999-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-14)
      • mutation (7)
    Domains in SCOPe 2.07: d1d5h.1
  • Chain 'B':
    Compound: RNAse s
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d5h.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5hA (A:)
    ketaaakaerqhmds
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5hB (B:)
    nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
    cretgsskypncaykttqankhiivacegnpyvpvhfdasv