PDB entry 1d5g

View 1d5g on RCSB PDB site
Description: solution structure of the pdz2 domain from human phosphatase hptp1e complexed with a peptide
Class: hydrolase
Keywords: protein-peptide complex, hydrolase
Deposited on 1999-10-07, released 2002-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human phosphatase hptp1e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d5ga_
  • Chain 'B':
    Compound: peptide fadseadeneqvsav
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1D5G (0-14)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d5gA (A:)
pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
vngvslegathkqavetlrntgqvvhlllekgqspt

  • Chain 'B':
    No sequence available.